PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000232291
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 404aa    MW: 45190.1 Da    PI: 8.5315
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000232291genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-16127172147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
    MDP0000232291 127 RGHWRPAEDSKLKELVTLYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 172
                      899*****************************.***********996 PP

2Myb_DNA-binding56.18.8e-18179222146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
    MDP0000232291 179 RRAFTEEEEEKLMQAHRIYGNK-WAMIARLFP-GRTDNALKNHWHV 222
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.27122173IPR017930Myb domain
SMARTSM007171.4E-13126175IPR001005SANT/Myb domain
SuperFamilySSF466898.8E-28127220IPR009057Homeodomain-like
PfamPF002493.7E-15127172IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-25128180IPR009057Homeodomain-like
CDDcd001674.27E-12130171No hitNo description
PROSITE profilePS5129427.002174228IPR017930Myb domain
SMARTSM007176.5E-15178226IPR001005SANT/Myb domain
PfamPF002494.1E-14179221IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-20181227IPR009057Homeodomain-like
CDDcd001679.97E-12181221No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MMANNGAIYA TENANVLSCF SSSSSSSPSS MGMVYADMGS LSLRSNCGVY SSVSSQDNSY  60
ISKLSEPENG RAFWGFPSTR SYEDHHNSSD MKGSEYTSSD HDKNPNESGV SVSERETENG  120
RLKLCARGHW RPAEDSKLKE LVTLYGPQNW NLIAEKLEGR SGKSCRLRWF NQLDPRINRR  180
AFTEEEEEKL MQAHRIYGNK WAMIARLFPG RTDNALKNHW HVIMARKYRK QSSAYRRKLN  240
QTVYRSVDEN PSVNAASRST EPPPPYVGLS LPNGGLSGGS SISDFFIWNK LLWWCWLWGR  300
KSNEVMGMMS QSRCRDGSGE VEDHSCGXMY THHPPPYMNM MAMQESNFHS LVHQSYSYSS  360
CQVSGGKPSP SASASDRVIG SGGGHRETSI PPPPFFDFLG VGGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-331272277107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.156700.0bud| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008361882.10.0PREDICTED: uncharacterized protein LOC103425569
TrEMBLD9ZJ601e-177D9ZJ60_MALDO; MYB domain class transcription factor
STRINGVIT_01s0026g02600.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-73myb domain protein 105